PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100273250021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family Dof
Protein Properties Length: 270aa    MW: 30106.3 Da    PI: 7.841
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100273250021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof77.22e-241574261
                        zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                                  +++ ++cprC+s  t+f y+nn s +qPry C++C+r Wt GG lr vP+Gg +r  k++
  Ote100273250021|100273250021 15 PKNPMRCPRCNSPSTRFRYFNNNSPTQPRYHCRSCKRQWTVGGRLRLVPIGGNTRSGKRK 74
                                  67889**************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-131566IPR003851Zinc finger, Dof-type
PfamPF027013.7E-241773IPR003851Zinc finger, Dof-type
PROSITE profilePS5088422.2191973IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MQRAVEETQQ QQNKPKNPMR CPRCNSPSTR FRYFNNNSPT QPRYHCRSCK RQWTVGGRLR  60
LVPIGGNTRS GKRKASSSGG GSAKSQAPQP PLPSEEQHRQ NLPLMNPMAS QNFDTALFQP  120
MTDMLAGVSP SNYFSDQISC SQTLIQQGSN QYDNGRNLFS SADTTMTIPQ EWNVQTIAPQ  180
HDLPQKNPIA FESYQTRNEV INGHSPHLCI DSVVQPVWPV KSLAQDITHD SSFTTSNASS  240
QKNLSGDTID IEDTNVNVDE WLNFPGSDPP
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1614456